PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G129700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 745aa    MW: 81819.3 Da    PI: 6.2946
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G129700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.3e-094865231954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  Aqcoe6G129700.1.p 486 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 523
                        664459******************************88 PP

2BELL126.97.2e-41348419172
               BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        erq+lq+k +kLls+l+eVd+rY+qy++q+q+v+ssF+++ag+g+akpYt+lAl +iSrhFrcL+dai++qi
  Aqcoe6G129700.1.p 348 ERQDLQNKLTKLLSMLDEVDRRYRQYYHQMQIVVSSFDVIAGCGAAKPYTALALETISRHFRCLRDAISGQI 419
                        799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.0E-63265417IPR006563POX domain
PfamPF075262.0E-49271416IPR006563POX domain
PROSITE profilePS5007112.163464527IPR001356Homeobox domain
CDDcd000865.16E-13467528No hitNo description
SMARTSM003891.0E-9467531IPR001356Homeobox domain
SuperFamilySSF466892.82E-17468534IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-29470533IPR009057Homeodomain-like
PfamPF059205.1E-18484523IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MATYFPSSSN QRNIVPTMYV RDSTATEYAE ASGLPNHMMM YMNYSSAGSY SDTIAGNSQQ  60
HQNCVDLPSV GASELSPSQQ GMLSNLVGSH TGDHVYNSWR DGRNEMFMQP IGGHTTIQSL  120
GAQISGARDD LVRDTVNEDP HQGLRPQLGV LDGGQNMQGQ GLSLSLSTQF SSAVPVPSFQ  180
FRHPNAGLSS FLASHPTISG EGGSGSGTCR DEENSPNKQS RNADYYQPGF QGGNHDAIKQ  240
EALNNLQGSL DPKQMHLVTS PYGLPGFAST IPNSKYLKAT QQLLDEVVNV RKALKQHDAG  300
KLQGVGSKSF RETDAGSKDS TTAPSTSGIP TDSQEQTSNS TVELSPGERQ DLQNKLTKLL  360
SMLDEVDRRY RQYYHQMQIV VSSFDVIAGC GAAKPYTALA LETISRHFRC LRDAISGQIK  420
ATRKSLGEQD TTGNSKGGGI SRLRFVDQQL RQQRALQQLG MMQQHAWRPQ RGLPESSVSI  480
LRAWLFEHFL HPYPKDSDKI MLARQTGLTR SQVSNWFINA RVRLWKPMVE EMYKEEFGDI  540
EMDSISSSDN ASKSARDDTK ISEDGREELQ QNANPSATER CQPSQFHDSK GNSVPDVDMS  600
GTLTSSSYQN RLQSEDDMGY MGMRLRGNQN HNVDHSNLLH DTLVQSDGSG TGRFISADAY  660
HHMAEMGRFG SGDGVSLTLG LQHRDGSGMP MSGGTHNNFV TMRGDEMYTA ATSLGPDTTD  720
YDCMDPEDRR HRFSSSHMLH DFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B9e-17473530158Homeobox protein Meis1
4xrs_A9e-17473530158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254698.10.0PREDICTED: BEL1-like homeodomain protein 6
SwissprotO656851e-132BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLV4RQC20.0V4RQC2_9R
STRINGVIT_03s0038g00050.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-119BEL1-like homeodomain 6